PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10000654m
Common NameCICLE_v10000654mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family WRKY
Protein Properties Length: 595aa    MW: 65014.4 Da    PI: 7.6198
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10000654mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1061.9e-33238295260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  Ciclev10000654m 238 DDGYNWRKYGQKQVKGSENPRSYYKCTFPSCPTKKKVERSL-DGQITEIVYKGSHNHPK 295
                      8****************************************.***************85 PP

2WRKY106.61.3e-33416474159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  Ciclev10000654m 416 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHD 474
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-28227296IPR003657WRKY domain
PROSITE profilePS5081123.915232296IPR003657WRKY domain
SuperFamilySSF1182902.48E-25233296IPR003657WRKY domain
SMARTSM007743.9E-36237295IPR003657WRKY domain
PfamPF031063.0E-25238294IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-37401476IPR003657WRKY domain
SuperFamilySSF1182901.24E-29408476IPR003657WRKY domain
PROSITE profilePS5081138.147411476IPR003657WRKY domain
SMARTSM007741.2E-39416475IPR003657WRKY domain
PfamPF031065.2E-26417474IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MASSSGNLDT LTNSHHHHPT NNFTFSTHPF MNPTSFTDLL TSSAPADHAQ LHSNNSNTTT  60
TTTTTTHGLS DRIAERTGSG VPKFKSIQPP SLPISPPSLF SPSSYFSIPA GLSPAELLDS  120
PVLLNTSNVL PSPTTGAFQT FNWKSNIGSN DQQRVKQENK NQSDFSFPTQ TRPNTTSSIA  180
QQNQPWNYQE STKQDVKLAQ SFSTTLQSNN QSNSGFQSDF GNYQHQQSQP IRESKKSDDG  240
YNWRKYGQKQ VKGSENPRSY YKCTFPSCPT KKKVERSLDG QITEIVYKGS HNHPKPQSTR  300
RSSSSSVNSN AIQASTQHSN EIQDQSYATH GSGQMDSAAT PENSSISVGD DDVDQGSQKS  360
KSGGGGAGGG DDFDEDEPEA KRWKIEGESE GISAPGSRTV REPRVVVQTT SDIDILDDGY  420
RWRKYGQKVV KGNPNPRSYY KCTHPGCPVR KHVERASHDL RAVITTYEGK HNHDVPAARG  480
SGSRALPDNS SNNNHNSNSN SNNNGTLPVR ASAVAHHPNN NSILNPVHNL RVSSSEGQAP  540
YTLEMLQGSG SFGFPGYGNA LRSYMNEGQQ QDNVLSRAKE EPRDHDTFFE SLLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-37238477878Probable WRKY transcription factor 4
2lex_A2e-37238477878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ccl.42790.0abscission zone| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7089841e-110JF708984.1 Dimocarpus longan WRKY transcription factor 36-3 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431962.10.0hypothetical protein CICLE_v10000654mg
TrEMBLV4SWP80.0V4SWP8_9R
STRINGPOPTR_0019s14460.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-111WRKY DNA-binding protein 33